PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR06G19690.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 273aa    MW: 29716.2 Da    PI: 8.2287
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR06G19690.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1521.5e-16104156355
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                      e kr rr+ +NRe+ArrsR+RK+a++  Le  v++L +eN +L k+l e +++
  LPERR06G19690.1 104 ETKRIRRMVSNRESARRSRRRKQAQLSDLESQVEQLRGENASLFKQLAETSQH 156
                      68*****************************************9877776655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-17102166IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.254104155IPR004827Basic-leucine zipper domain
PfamPF001701.5E-14104155IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.8E-13106155No hitNo description
SuperFamilySSF579591.37E-12106157No hitNo description
PROSITE patternPS000360109124IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MKKCPSELQL EAFIAGDGKL HGQGGFFSSS GEMSDLGFVD SNTLDGRRPE SIRTPPRHAF  60
SSISASPKAS TSANNGPESE SDSDSESLLD TERSPRLRGT RSTETKRIRR MVSNRESARR  120
SRRRKQAQLS DLESQVEQLR GENASLFKQL AETSQHFTTA VTDNRVLKSD VEALRVKVKM  180
AEDMVARATM SCGLGQLGLA PLLNSRKMCQ ALDMLAVTGL DLPRDGASFK GFNPSRQIQN  240
SPVQSAASLD SLDNRISSEV TSCSADEICA SFH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1118125RRSRRRKQ
2120125SRRRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015643805.11e-111PREDICTED: basic leucine zipper 9
TrEMBLA0A0D9WSX00.0A0A0D9WSX0_9ORYZ; Uncharacterized protein
STRINGBGIOSGA020738-PA1e-111(Oryza sativa Indica Group)
STRINGLOC_Os06g45140.11e-111(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20953796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24800.14e-26basic leucine zipper 9